PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 228aa    MW: 25747.2 Da    PI: 10.4757
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42917.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l  +++++G g+W++ +++ g+ R++k+c++rw +yl
       KHN42917.1 14 KGPWTPEEDQKLMAYIEEFGHGSWRALPAKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.21.4e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia+ ++ +Rt++++k++w+++l
       KHN42917.1  67 RGKFSLQEEQTIIQLHALLGNR-WSAIAAQLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.682961IPR017930Myb domain
SuperFamilySSF466891.8E-3011108IPR009057Homeodomain-like
SMARTSM007178.3E-131363IPR001005SANT/Myb domain
PfamPF002496.0E-161461IPR001005SANT/Myb domain
CDDcd001671.19E-101661No hitNo description
PROSITE profilePS5129425.2962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2665116IPR009057Homeodomain-like
SMARTSM007174.9E-1666114IPR001005SANT/Myb domain
PfamPF002496.3E-1667112IPR001005SANT/Myb domain
CDDcd001672.06E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MGRSPCCEKE GLKKGPWTPE EDQKLMAYIE EFGHGSWRAL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIAAQLPKRT DNEIKNYWNT HLKKRLTRMG  120
IDPTTHKPKT DALGGPNQGR GEPQPHGAVG ERQARSRSET RERIKAASPE QPGIMLQHTT  180
CETCSQQNHN TTTTLAATVP RHPQSMAKLV EQTATTTNNK RKQHQDNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150345e-75AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528577.18e-98PREDICTED: protein ODORANT1-like
SwissprotQ8GWP03e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0B2SF191e-171A0A0B2SF19_GLYSO; Transcription factor MYB39
STRINGGLYMA07G35561.13e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.21e-89myb domain protein 16
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]